PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00020.1.g05820.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 189aa    MW: 21329.5 Da    PI: 9.6291
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00020.1.g05820.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like70.91.9e-22133182151
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   k rl+W+ +LH++F+ av++L G+ek +Pk+ile+m+vk Lt+e+v+SHLQ
  Zjn_sc00020.1.g05820.1.sm.mk 133 KSRLNWSLQLHRQFITAVNSL-GAEKSVPKKILEAMNVKNLTREQVASHLQ 182
                                   68*******************.9**************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23006.6E-5838No hitNo description
SuperFamilySSF521726.95E-10993IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.8E-73985No hitNo description
SuperFamilySSF466899.5E-14131182IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-21132182IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-20133183IPR006447Myb domain, plants
PfamPF002492.6E-6135182IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MDQAKIWPSG IRVLVIDDNT SNLTVMEELL SKCSYKGTVL KYIANGASDF LIKPVRIEEL  60
KNIWQHVFRK KIGEEQSKTY NAQHGTDQLF YRSNITPASY PARTTGMAEA AMAMESEVRE  120
TSGTVTDVRD LRKSRLNWSL QLHRQFITAV NSLGAEKSVP KKILEAMNVK NLTREQVASH  180
LQVSGCEKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-14132182454ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982951.17e-66PREDICTED: two-component response regulator EHD1-like
SwissprotQ7Y0W36e-49EHD1_ORYSI; Two-component response regulator EHD1
SwissprotQ7Y0W56e-49ORR30_ORYSJ; Two-component response regulator ORR30
TrEMBLK4AM572e-65K4AM57_SETIT; Uncharacterized protein
STRINGSi039992m6e-65(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112222741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.13e-33response regulator 2